Lineage for d1z6od_ (1z6o D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1991065Species Trichoplusia ni [TaxId:7111] [188170] (1 PDB entry)
  8. 1991068Domain d1z6od_: 1z6o D: [124534]
    Other proteins in same PDB: d1z6oa1, d1z6om1, d1z6on_, d1z6oo_, d1z6op_, d1z6oq_, d1z6or_, d1z6os_, d1z6ot_, d1z6ou_, d1z6ov_, d1z6ow_, d1z6ox_
    automated match to d1z6oa1
    complexed with ca, fe

Details for d1z6od_

PDB Entry: 1z6o (more details), 1.91 Å

PDB Description: Crystal Structure of Trichoplusia ni secreted ferritin
PDB Compounds: (D:) ferritin light chain

SCOPe Domain Sequences for d1z6od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6od_ a.25.1.1 (D:) automated matches {Trichoplusia ni [TaxId: 7111]}
adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
htsdlkkfitannghdlslalyvfdeylqktv

SCOPe Domain Coordinates for d1z6od_:

Click to download the PDB-style file with coordinates for d1z6od_.
(The format of our PDB-style files is described here.)

Timeline for d1z6od_: