SCOP 1.73: Domain d1z6na1: 1z6n A:1-166

Lineage for d1z6na1 (1z6n A:1-166)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Hypothetical protein PA1234 [142353] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142354] (1 PDB entry)

8. Domain d1z6na1: 1z6n A:1-166 [124530]
   complexed with mg

Details for d1z6na1

PDB Entry: 1z6n, 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function PA1234 from Pseudomonas aeruginosa

PDB Compounds: (A:) hypothetical protein PA1234

SCOP Domain Sequences for d1z6na1:

Sequence; same for both SEQRES and ATOM records:

>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]}
masyaelfdigedfaafvghglateqgavarfrqklesnglpsalterlqrierryrllv
agemwcpdcqinlaaldfaqrlqpnielaiiskgraeddlrqrlaleriaiplvlvldee
fnllgrfverpqavldggpqalaaykagdylehaigdvlaiiegaa

Timeline for d1z6na1:

• d1z6na1 is new in SCOP 1.73
  
• d1z6na1 appears in SCOP 1.75
  
• d1z6na1 appears in the current release, SCOPe 2.08