Lineage for d1z6na1 (1z6n A:1-166)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876164Protein Hypothetical protein PA1234 [142353] (1 species)
  7. 2876165Species Pseudomonas aeruginosa [TaxId:287] [142354] (1 PDB entry)
    Uniprot Q9I4A4 1-166
  8. 2876166Domain d1z6na1: 1z6n A:1-166 [124530]
    complexed with mg

Details for d1z6na1

PDB Entry: 1z6n (more details), 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function PA1234 from Pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein PA1234

SCOPe Domain Sequences for d1z6na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]}
masyaelfdigedfaafvghglateqgavarfrqklesnglpsalterlqrierryrllv
agemwcpdcqinlaaldfaqrlqpnielaiiskgraeddlrqrlaleriaiplvlvldee
fnllgrfverpqavldggpqalaaykagdylehaigdvlaiiegaa

SCOPe Domain Coordinates for d1z6na1:

Click to download the PDB-style file with coordinates for d1z6na1.
(The format of our PDB-style files is described here.)

Timeline for d1z6na1: