SCOPe 2.06: Domain d1z6jt2: 1z6j T:109-209

Lineage for d1z6jt2 (1z6j T:109-209)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
   Uniprot P13726 33-242

8. Domain d1z6jt2: 1z6j T:109-209 [124528]
   Other proteins in same PDB: d1z6jh_, d1z6jl1, d1z6jl2, d1z6jl3
   automatically matched to d1a21a2
   complexed with ca, mg, py3

Details for d1z6jt2

PDB Entry: 1z6j, 2 Å

PDB Description: crystal structure of a ternary complex of factor viia/tissue factor/pyrazinone inhibitor

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1z6jt2:

Sequence; same for both SEQRES and ATOM records:

>d1z6jt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec

Timeline for d1z6jt2:

• d1z6jt2 first appeared in SCOP 1.73
  
• d1z6jt2 appears in SCOPe 2.05
  
• d1z6jt2 appears in SCOPe 2.07
  
• d1z6jt2 appears in the current release, SCOPe 2.08