Lineage for d1z6jt2 (1z6j T:109-209)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 935829Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 935858Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)
  8. 935866Domain d1z6jt2: 1z6j T:109-209 [124528]
    Other proteins in same PDB: d1z6jh_, d1z6jl1, d1z6jl2, d1z6jl3
    automatically matched to d1a21a2
    complexed with ca, mg, py3

Details for d1z6jt2

PDB Entry: 1z6j (more details), 2 Å

PDB Description: crystal structure of a ternary complex of factor viia/tissue factor/pyrazinone inhibitor
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1z6jt2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6jt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec

SCOPe Domain Coordinates for d1z6jt2:

Click to download the PDB-style file with coordinates for d1z6jt2.
(The format of our PDB-style files is described here.)

Timeline for d1z6jt2: