![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (44 proteins) Pfam PF00041 |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries) |
![]() | Domain d1z6jt2: 1z6j T:109-209 [124528] Other proteins in same PDB: d1z6jh1, d1z6jl1, d1z6jl2, d1z6jl3 automatically matched to d1a21a2 complexed with ca, mg, py3 |
PDB Entry: 1z6j (more details), 2 Å
SCOP Domain Sequences for d1z6jt2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6jt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec
Timeline for d1z6jt2:
![]() Domains from other chains: (mouse over for more information) d1z6jh1, d1z6jl1, d1z6jl2, d1z6jl3 |