Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
Domain d1z6jl2: 1z6j L:87-142 [124525] Other proteins in same PDB: d1z6jh_, d1z6jl3, d1z6jt1, d1z6jt2 automated match to d2a2ql2 complexed with ca, mg, py3 |
PDB Entry: 1z6j (more details), 2 Å
SCOPe Domain Sequences for d1z6jl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6jl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d1z6jl2: