SCOPe 2.01: Domain d1z6jl2: 1z6j L:91-140

Lineage for d1z6jl2 (1z6j L:91-140)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)

8. Domain d1z6jl2: 1z6j L:91-140 [124525]
   Other proteins in same PDB: d1z6jh_, d1z6jl3, d1z6jt1, d1z6jt2
   automatically matched to d1pfxl2
   complexed with ca, mg, py3

Details for d1z6jl2

PDB Entry: 1z6j, 2 Å

PDB Description: crystal structure of a ternary complex of factor viia/tissue factor/pyrazinone inhibitor

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1z6jl2:

Sequence; same for both SEQRES and ATOM records:

>d1z6jl2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

Timeline for d1z6jl2:

• d1z6jl2 first appeared in SCOP 1.73
  
• d1z6jl2 appears in SCOP 1.75
  
• d1z6jl2 appears in SCOPe 2.02
  
• d1z6jl2 appears in the current release, SCOPe 2.08