Lineage for d1z6jl2 (1z6j L:87-142)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031147Protein Coagulation factor VIIa [57201] (1 species)
  7. 3031148Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 3031224Domain d1z6jl2: 1z6j L:87-142 [124525]
    Other proteins in same PDB: d1z6jh_, d1z6jl3, d1z6jt1, d1z6jt2
    automated match to d2a2ql2
    complexed with ca, mg, py3

Details for d1z6jl2

PDB Entry: 1z6j (more details), 2 Å

PDB Description: crystal structure of a ternary complex of factor viia/tissue factor/pyrazinone inhibitor
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1z6jl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6jl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d1z6jl2:

Click to download the PDB-style file with coordinates for d1z6jl2.
(The format of our PDB-style files is described here.)

Timeline for d1z6jl2: