SCOPe 2.04: Domain d1z6jl1: 1z6j L:49-86

Lineage for d1z6jl1 (1z6j L:49-86)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (45 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d1z6jl1: 1z6j L:49-86 [124524]
   Other proteins in same PDB: d1z6jh_, d1z6jl3, d1z6jt1, d1z6jt2
   automated match to d2a2ql1
   complexed with ca, mg, py3

Details for d1z6jl1

PDB Entry: 1z6j, 2 Å

PDB Description: crystal structure of a ternary complex of factor viia/tissue factor/pyrazinone inhibitor

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1z6jl1:

Sequence; same for both SEQRES and ATOM records:

>d1z6jl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

Timeline for d1z6jl1:

• d1z6jl1 first appeared in SCOP 1.73
  
• d1z6jl1 appears in SCOPe 2.03
  
• d1z6jl1 appears in SCOPe 2.05
  
• d1z6jl1 appears in the current release, SCOPe 2.08