Class g: Small proteins [56992] (85 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Factor IX (IXa) [57198] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries) |
Domain d1z6jl1: 1z6j L:46-82 [124524] Other proteins in same PDB: d1z6jh1, d1z6jl3, d1z6jt1, d1z6jt2 automatically matched to d1pfxl1 complexed with ca, mg, py3 |
PDB Entry: 1z6j (more details), 2 Å
SCOP Domain Sequences for d1z6jl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6jl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} dgdqcasspcqnggsckdqlqsyicfclpafegrnce
Timeline for d1z6jl1: