SCOPe 2.08: Domain d1z6fa2: 1z6f A:4-262

Lineage for d1z6fa2 (1z6f A:4-262)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Penicillin-binding protein 5, N-terminal domain [69875] (1 species)

7. Species Escherichia coli [TaxId:562] [69876] (11 PDB entries)

8. Domain d1z6fa2: 1z6f A:4-262 [124521]
   Other proteins in same PDB: d1z6fa1
   automated match to d1nzoa2
   complexed with bo9, gol

Details for d1z6fa2

PDB Entry: 1z6f, 1.6 Å

PDB Description: crystal structure of penicillin-binding protein 5 from e. coli in complex with a boronic acid inhibitor

PDB Compounds: (A:) penicillin-binding protein 5

SCOPe Domain Sequences for d1z6fa2:

Sequence; same for both SEQRES and ATOM records:

>d1z6fa2 e.3.1.1 (A:4-262) Penicillin-binding protein 5, N-terminal domain {Escherichia coli [TaxId: 562]}
niktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamkagkf
ketdlvtigndawatgnpvfkgsslmflkpgmqvpvsqlirginlqsgndacvamadfaa
gsqdafvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpneysiy
kekeftfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavmggr
tfkgreaeskklltwgfrf

Timeline for d1z6fa2:

• d1z6fa2 first appeared in SCOP 1.73
  
• d1z6fa2 appears in SCOPe 2.07