SCOP 1.73: Domain d1z6fa1: 1z6f A:263-356

Lineage for d1z6fa1 (1z6f A:263-356)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (2 families)

5. Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins)

6. Protein Penicillin-binding protein 5, C-terminal domain [69191] (1 species)

7. Species Escherichia coli [TaxId:562] [69192] (6 PDB entries)

8. Domain d1z6fa1: 1z6f A:263-356 [124520]
   Other proteins in same PDB: d1z6fa2
   automatically matched to d1hd8a1
   complexed with bo9, gol

Details for d1z6fa1

PDB Entry: 1z6f, 1.6 Å

PDB Description: crystal structure of penicillin-binding protein 5 from e. coli in complex with a boronic acid inhibitor

PDB Compounds: (A:) penicillin-binding protein 5

SCOP Domain Sequences for d1z6fa1:

Sequence; same for both SEQRES and ATOM records:

>d1z6fa1 b.105.1.1 (A:263-356) Penicillin-binding protein 5, C-terminal domain {Escherichia coli [TaxId: 562]}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipegn

Timeline for d1z6fa1:

• d1z6fa1 is new in SCOP 1.73
  
• d1z6fa1 appears in SCOP 1.75
  
• d1z6fa1 appears in the current release, SCOPe 2.08