Lineage for d1z6bf1 (1z6b F:84-228)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858962Family d.38.1.6: FabZ-like [110902] (1 protein)
  6. 858963Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (2 species)
  7. 858964Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (2 PDB entries)
    Uniprot Q965D7 84-229! Uniprot Q965D7 94-229
  8. 858970Domain d1z6bf1: 1z6b F:84-228 [124515]
    automatically matched to 1Z6B A:84-229
    complexed with cac, cl, so4

Details for d1z6bf1

PDB Entry: 1z6b (more details), 2.09 Å

PDB Description: crystal structure of plasmodium falciparum fabz at 2.1 a
PDB Compounds: (F:) fatty acid synthesis protein

SCOP Domain Sequences for d1z6bf1:

Sequence, based on SEQRES records: (download)

>d1z6bf1 d.38.1.6 (F:84-228) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
iaklsgvgyvngkvvinisemtfal

Sequence, based on observed residues (ATOM records): (download)

>d1z6bf1 d.38.1.6 (F:84-228) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
lqiealaqlagilclksdnnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiakl
sgvgyvngkvvinisemtfal

SCOP Domain Coordinates for d1z6bf1:

Click to download the PDB-style file with coordinates for d1z6bf1.
(The format of our PDB-style files is described here.)

Timeline for d1z6bf1: