Lineage for d1z6bb1 (1z6b B:85-227)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721694Family d.38.1.6: FabZ-like [110902] (1 protein)
  6. 721695Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (2 species)
  7. 721696Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (2 PDB entries)
  8. 721698Domain d1z6bb1: 1z6b B:85-227 [124511]
    automatically matched to 1Z6B A:84-229
    complexed with cac, cl, so4

Details for d1z6bb1

PDB Entry: 1z6b (more details), 2.09 Å

PDB Description: crystal structure of plasmodium falciparum fabz at 2.1 a
PDB Compounds: (B:) fatty acid synthesis protein

SCOP Domain Sequences for d1z6bb1:

Sequence, based on SEQRES records: (download)

>d1z6bb1 d.38.1.6 (B:85-227) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
aklsgvgyvngkvvinisemtfa

Sequence, based on observed residues (ATOM records): (download)

>d1z6bb1 d.38.1.6 (B:85-227) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
qiealaqlagilclksdlfagvdgvrwkkpvlpgdtltmqanlisfkgiaklsgvgyvng
kvvinisemtfa

SCOP Domain Coordinates for d1z6bb1:

Click to download the PDB-style file with coordinates for d1z6bb1.
(The format of our PDB-style files is described here.)

Timeline for d1z6bb1: