Lineage for d1z6ba1 (1z6b A:84-229)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2511612Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2511613Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2512130Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 2512131Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 2512231Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (8 PDB entries)
    Uniprot Q965D7 84-229! Uniprot Q965D7 94-229
  8. 2512234Domain d1z6ba1: 1z6b A:84-229 [124510]
    complexed with cac, cl, so4

Details for d1z6ba1

PDB Entry: 1z6b (more details), 2.09 Å

PDB Description: crystal structure of plasmodium falciparum fabz at 2.1 a
PDB Compounds: (A:) fatty acid synthesis protein

SCOPe Domain Sequences for d1z6ba1:

Sequence, based on SEQRES records: (download)

>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
iaklsgvgyvngkvvinisemtfals

Sequence, based on observed residues (ATOM records): (download)

>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
lqiealaqlagilclksdnnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiakl
sgvgyvngkvvinisemtfals

SCOPe Domain Coordinates for d1z6ba1:

Click to download the PDB-style file with coordinates for d1z6ba1.
(The format of our PDB-style files is described here.)

Timeline for d1z6ba1: