Lineage for d1z6aa2 (1z6a A:662-904)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478770Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2479005Protein automated matches [190301] (6 species)
    not a true protein
  7. 2479029Species Sulfolobus solfataricus [TaxId:273057] [267761] (1 PDB entry)
  8. 2479030Domain d1z6aa2: 1z6a A:662-904 [124509]
    Other proteins in same PDB: d1z6aa4
    automated match to d1z5zb_
    complexed with hg, po4

Details for d1z6aa2

PDB Entry: 1z6a (more details), 3 Å

PDB Description: sulfolobus solfataricus swi2/snf2 atpase core domain
PDB Compounds: (A:) Helicase of the snf2/rad54 family

SCOPe Domain Sequences for d1z6aa2:

Sequence, based on SEQRES records: (download)

>d1z6aa2 c.37.1.19 (A:662-904) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
dkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpallk
ggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpflyge
lskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfdrwwnpavedqatdrv
yrigqtrnvivhklisvgtleekidqllafkrslfkdiissgdswitelsteelrkviel
svg

Sequence, based on observed residues (ATOM records): (download)

>d1z6aa2 c.37.1.19 (A:662-904) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
dkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpallk
ggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpflyge
lskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfdrwwdqatdrvyrigq
trnvivhklisvgtleekidqllafkrslfkdiissgdswitelsteelrkvielsvg

SCOPe Domain Coordinates for d1z6aa2:

Click to download the PDB-style file with coordinates for d1z6aa2.
(The format of our PDB-style files is described here.)

Timeline for d1z6aa2: