SCOPe 2.04: Domain d1z66a_: 1z66 A:

Lineage for d1z66a_ (1z66 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (39 species)
   not a true protein

7. Species Langat virus [TaxId:11085] [255004] (1 PDB entry)

8. Domain d1z66a_: 1z66 A: [124506]
   automated match to d1s6na_

Details for d1z66a_

PDB Entry: 1z66

PDB Description: nmr solution structure of domain iii of e-protein of tick-borne langat flavivirus (no rdc restraints)

PDB Compounds: (A:) major envelope protein E

SCOPe Domain Sequences for d1z66a_:

Sequence; same for both SEQRES and ATOM records:

>d1z66a_ b.1.18.0 (A:) automated matches {Langat virus [TaxId: 11085]}
tytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlitpnp
tmenngggfiemqlppgdniiyvgdlnhqwfqk

Timeline for d1z66a_:

• d1z66a_ first appeared in SCOP 1.73, called d1z66a1
  
• d1z66a_ was called d1z66a1 in SCOPe 2.03
  
• d1z66a_ appears in SCOPe 2.05
  
• d1z66a_ appears in the current release, SCOPe 2.08