Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (39 species) not a true protein |
Species Langat virus [TaxId:11085] [255004] (1 PDB entry) |
Domain d1z66a_: 1z66 A: [124506] automated match to d1s6na_ |
PDB Entry: 1z66 (more details)
SCOPe Domain Sequences for d1z66a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z66a_ b.1.18.0 (A:) automated matches {Langat virus [TaxId: 11085]} tytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlitpnp tmenngggfiemqlppgdniiyvgdlnhqwfqk
Timeline for d1z66a_: