Lineage for d1z63b2 (1z63 B:662-903)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831899Family c.37.1.19: Tandem AAA-ATPase domain [81268] (23 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 831964Protein Helicase of the SNF2/Rad54 hamily [142312] (1 species)
  7. 831965Species Sulfolobus solfataricus [TaxId:2287] [142313] (3 PDB entries)
    Uniprot Q97XQ7 432-661! Uniprot Q97XQ7 662-802! Uniprot Q97XQ7 663-802
  8. 831971Domain d1z63b2: 1z63 B:662-903 [124505]
    automatically matched to 1Z63 A:662-903

Details for d1z63b2

PDB Entry: 1z63 (more details), 3 Å

PDB Description: sulfolobus solfataricus swi2/snf2 atpase core in complex with dsdna
PDB Compounds: (B:) Helicase of the snf2/rad54 hamily

SCOP Domain Sequences for d1z63b2:

Sequence, based on SEQRES records: (download)

>d1z63b2 c.37.1.19 (B:662-903) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}
dkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpallk
ggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpflyge
lskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfdrwwnpavedqatdrv
yrigqtrnvivhklisvgtleekidqllafkrslfkdiissgdswitelsteelrkviel
sv

Sequence, based on observed residues (ATOM records): (download)

>d1z63b2 c.37.1.19 (B:662-903) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}
dkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpallk
ggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpflyge
lskkerddiiskfqnnpsvkfivlsvkagfginltsanrvihfdrwwnpdqatdrvyrig
qtrnvivhklisvgtleekidqllafkrslfkdiissgdswitelsteelrkvielsv

SCOP Domain Coordinates for d1z63b2:

Click to download the PDB-style file with coordinates for d1z63b2.
(The format of our PDB-style files is described here.)

Timeline for d1z63b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z63b1