SCOPe 2.07: Domain d1z63b1: 1z63 B:432-661

Lineage for d1z63b1 (1z63 B:432-661)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein automated matches [190301] (6 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [267762] (1 PDB entry)

8. Domain d1z63b1: 1z63 B:432-661 [124504]
   Other proteins in same PDB: d1z63a1, d1z63a2
   automated match to d1z63a1
   protein/DNA complex

Details for d1z63b1

PDB Entry: 1z63, 3 Å

PDB Description: sulfolobus solfataricus swi2/snf2 atpase core in complex with dsdna

PDB Compounds: (B:) Helicase of the snf2/rad54 family

SCOPe Domain Sequences for d1z63b1:

Sequence; same for both SEQRES and ATOM records:

>d1z63b1 c.37.1.19 (B:432-661) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
fqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqtiavfsdakkene
ltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiilttyavllrdtrl
kevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvddlwsimtflnpg
llgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiindlp

Timeline for d1z63b1:

• d1z63b1 first appeared in SCOP 1.73
  
• d1z63b1 appears in SCOPe 2.06
  
• d1z63b1 appears in the current release, SCOPe 2.08