SCOP 1.75: Domain d1z5ye1: 1z5y E:49-184

Lineage for d1z5ye1 (1z5y E:49-184)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)

6. Protein Thioredoxin-like protein CcmG (CycY, DsbE) [75237] (2 species)

7. Species Escherichia coli [TaxId:562] [142370] (1 PDB entry)
   Uniprot P0AA86 49-184

8. Domain d1z5ye1: 1z5y E:49-184 [124498]
   Other proteins in same PDB: d1z5yd1
   complexed with cl, edo; mutant

Details for d1z5ye1

PDB Entry: 1z5y, 1.94 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal domain of the electron transfer catalyst dsbd and the cytochrome c biogenesis protein ccmg

PDB Compounds: (E:) Thiol:disulfide interchange protein dsbE

SCOP Domain Sequences for d1z5ye1:

Sequence; same for both SEQRES and ATOM records:

>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]}
rlesldnpgqfyqadvltqgkpvllnvwatwcptsraehqylnqlsaqgirvvgmnykdd
rqkaiswlkelgnpyalslfdgdgmlgldlgvygapetflidgngiiryrhagdlnprvw
eeeikplwekyskeaa

Timeline for d1z5ye1:

• d1z5ye1 first appeared in SCOP 1.73
  
• d1z5ye1 appears in SCOPe 2.01
  
• d1z5ye1 appears in the current release, SCOPe 2.08