![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Thioredoxin-like protein CcmG (CycY, DsbE) [75237] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [142370] (1 PDB entry) Uniprot P0AA86 49-184 |
![]() | Domain d1z5ye1: 1z5y E:49-184 [124498] Other proteins in same PDB: d1z5yd_ complexed with cl, edo |
PDB Entry: 1z5y (more details), 1.94 Å
SCOPe Domain Sequences for d1z5ye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} rlesldnpgqfyqadvltqgkpvllnvwatwcptsraehqylnqlsaqgirvvgmnykdd rqkaiswlkelgnpyalslfdgdgmlgldlgvygapetflidgngiiryrhagdlnprvw eeeikplwekyskeaa
Timeline for d1z5ye1: