Lineage for d1z5yd_ (1z5y D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038549Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) (S)
  5. 2038550Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)
  6. 2038551Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)
  7. 2038552Species Escherichia coli [TaxId:562] [74866] (6 PDB entries)
  8. 2038555Domain d1z5yd_: 1z5y D: [124497]
    Other proteins in same PDB: d1z5ye1
    automated match to d1vrsa1
    complexed with cl, edo

Details for d1z5yd_

PDB Entry: 1z5y (more details), 1.94 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal domain of the electron transfer catalyst dsbd and the cytochrome c biogenesis protein ccmg
PDB Compounds: (D:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1z5yd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5yd_ b.1.17.1 (D:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
rsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhe
defygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplsevvan

SCOPe Domain Coordinates for d1z5yd_:

Click to download the PDB-style file with coordinates for d1z5yd_.
(The format of our PDB-style files is described here.)

Timeline for d1z5yd_: