SCOPe 2.05: Domain d1z5ua_: 1z5u A:

Lineage for d1z5ua_ (1z5u A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin
   automatically mapped to Pfam PF03767

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [142153] (4 PDB entries)
   Uniprot P58683 30-237

8. Domain d1z5ua_: 1z5u A: [124493]
   automated match to d1rm7a_
   complexed with cmp, mg

Details for d1z5ua_

PDB Entry: 1z5u, 2.3 Å

PDB Description: crystal structure of s. typhimurium apha complexed with cyclic-amp

PDB Compounds: (A:) AphA protein

SCOPe Domain Sequences for d1z5ua_:

Sequence; same for both SEQRES and ATOM records:

>d1z5ua_ c.108.1.12 (A:) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]}
tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
tladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirgir
ilraanstykplpqagafgeevivnsey

Timeline for d1z5ua_:

• d1z5ua_ first appeared in SCOP 1.73, called d1z5ua1
  
• d1z5ua_ appears in SCOPe 2.04
  
• d1z5ua_ appears in SCOPe 2.06
  
• d1z5ua_ appears in the current release, SCOPe 2.08