Lineage for d1z5ua_ (1z5u A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920045Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
    automatically mapped to Pfam PF03767
  6. 2920046Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 2920074Species Salmonella typhimurium [TaxId:90371] [142153] (4 PDB entries)
    Uniprot P58683 30-237
  8. 2920087Domain d1z5ua_: 1z5u A: [124493]
    automated match to d1rm7a_
    complexed with cmp, mg

Details for d1z5ua_

PDB Entry: 1z5u (more details), 2.3 Å

PDB Description: crystal structure of s. typhimurium apha complexed with cyclic-amp
PDB Compounds: (A:) AphA protein

SCOPe Domain Sequences for d1z5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5ua_ c.108.1.12 (A:) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]}
tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
tladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirgir
ilraanstykplpqagafgeevivnsey

SCOPe Domain Coordinates for d1z5ua_:

Click to download the PDB-style file with coordinates for d1z5ua_.
(The format of our PDB-style files is described here.)

Timeline for d1z5ua_: