SCOPe 2.07: Domain d1z5sb_: 1z5s B:

Lineage for d1z5sb_ (1z5s B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)

8. Domain d1z5sb_: 1z5s B: [124492]
   Other proteins in same PDB: d1z5sa_, d1z5sc1
   automated match to d1y8rc_

Details for d1z5sb_

PDB Entry: 1z5s, 3.01 Å

PDB Description: crystal structure of a complex between ubc9, sumo-1, rangap1 and nup358/ranbp2

PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOPe Domain Sequences for d1z5sb_:

Sequence; same for both SEQRES and ATOM records:

>d1z5sb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

Timeline for d1z5sb_:

• d1z5sb_ first appeared in SCOP 1.73, called d1z5sb1
  
• d1z5sb_ appears in SCOPe 2.06
  
• d1z5sb_ appears in the current release, SCOPe 2.08