Lineage for d1z5sb1 (1z5s B:20-97)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1017617Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1017711Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 1017717Species Human (Homo sapiens) [TaxId:9606] [54242] (12 PDB entries)
    Uniprot Q93068
  8. 1017728Domain d1z5sb1: 1z5s B:20-97 [124492]
    Other proteins in same PDB: d1z5sa1, d1z5sc1
    automatically matched to d1tgzb_

Details for d1z5sb1

PDB Entry: 1z5s (more details), 3.01 Å

PDB Description: crystal structure of a complex between ubc9, sumo-1, rangap1 and nup358/ranbp2
PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOPe Domain Sequences for d1z5sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5sb1 d.15.1.1 (B:20-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

SCOPe Domain Coordinates for d1z5sb1:

Click to download the PDB-style file with coordinates for d1z5sb1.
(The format of our PDB-style files is described here.)

Timeline for d1z5sb1: