SCOP 1.75: Domain d1z5sb1: 1z5s B:20-97

Lineage for d1z5sb1 (1z5s B:20-97)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54242] (14 PDB entries)
   Uniprot Q93068

8. Domain d1z5sb1: 1z5s B:20-97 [124492]
   Other proteins in same PDB: d1z5sa1, d1z5sc1
   automatically matched to d1tgzb_

Details for d1z5sb1

PDB Entry: 1z5s, 3.01 Å

PDB Description: crystal structure of a complex between ubc9, sumo-1, rangap1 and nup358/ranbp2

PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOP Domain Sequences for d1z5sb1:

Sequence; same for both SEQRES and ATOM records:

>d1z5sb1 d.15.1.1 (B:20-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

Timeline for d1z5sb1:

• d1z5sb1 first appeared in SCOP 1.73
  
• d1z5sb1 appears in SCOPe 2.01
  
• d1z5sb1 appears in the current release, SCOPe 2.08, called d1z5sb_