SCOP 1.73: Domain d1z5rc1: 1z5r C:6-308

Lineage for d1z5rc1 (1z5r C:6-308)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)

6. Protein Carboxypeptidase B [53193] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [53194] (5 PDB entries)

8. Domain d1z5rc1: 1z5r C:6-308 [124490]
   automatically matched to 1Z5R A:6-308
   complexed with zn

Details for d1z5rc1

PDB Entry: 1z5r, 1.4 Å

PDB Description: crystal structure of activated porcine pancreatic carboxypeptidase b

PDB Compounds: (C:) Procarboxypeptidase B

SCOP Domain Sequences for d1z5rc1:

Sequence; same for both SEQRES and ATOM records:

>d1z5rc1 c.56.5.1 (C:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
lghl

Timeline for d1z5rc1:

• d1z5rc1 is new in SCOP 1.73
  
• d1z5rc1 appears in SCOP 1.75
  
• d1z5rc1 appears in the current release, SCOPe 2.08, called d1z5rc_