![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins) |
![]() | Protein Carboxypeptidase B [53193] (4 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [53194] (5 PDB entries) |
![]() | Domain d1z5rc1: 1z5r C:6-308 [124490] automatically matched to 1Z5R A:6-308 complexed with zn |
PDB Entry: 1z5r (more details), 1.4 Å
SCOP Domain Sequences for d1z5rc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5rc1 c.56.5.1 (C:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv lghl
Timeline for d1z5rc1: