Lineage for d1z5rb_ (1z5r B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889495Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2889604Protein automated matches [190397] (2 species)
    not a true protein
  7. 2889617Species Pig (Sus scrofa) [TaxId:9823] [187266] (20 PDB entries)
  8. 2889651Domain d1z5rb_: 1z5r B: [124489]
    Other proteins in same PDB: d1z5ra1
    automated match to d1z5ra1
    complexed with zn

Details for d1z5rb_

PDB Entry: 1z5r (more details), 1.4 Å

PDB Description: crystal structure of activated porcine pancreatic carboxypeptidase b
PDB Compounds: (B:) Procarboxypeptidase B

SCOPe Domain Sequences for d1z5rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5rb_ c.56.5.1 (B:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
lghl

SCOPe Domain Coordinates for d1z5rb_:

Click to download the PDB-style file with coordinates for d1z5rb_.
(The format of our PDB-style files is described here.)

Timeline for d1z5rb_: