Lineage for d1z5ra1 (1z5r A:6-308)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 703083Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 703084Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)
  6. 703137Protein Carboxypeptidase B [53193] (4 species)
  7. 703147Species Pig (Sus scrofa) [TaxId:9823] [53194] (5 PDB entries)
  8. 703148Domain d1z5ra1: 1z5r A:6-308 [124488]
    complexed with zn

Details for d1z5ra1

PDB Entry: 1z5r (more details), 1.4 Å

PDB Description: crystal structure of activated porcine pancreatic carboxypeptidase b
PDB Compounds: (A:) Procarboxypeptidase B

SCOP Domain Sequences for d1z5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
lghl

SCOP Domain Coordinates for d1z5ra1:

Click to download the PDB-style file with coordinates for d1z5ra1.
(The format of our PDB-style files is described here.)

Timeline for d1z5ra1: