Lineage for d1z5pa_ (1z5p A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2495717Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (3 species)
  7. 2495718Species Escherichia coli [TaxId:562] [82449] (8 PDB entries)
  8. 2495723Domain d1z5pa_: 1z5p A: [124487]
    automated match to d1nc3a_
    complexed with gol, ipa, pe5

Details for d1z5pa_

PDB Entry: 1z5p (more details), 2 Å

PDB Description: Crystal structure of MTA/AdoHcy nucleosidase with a ligand-free purine binding site
PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d1z5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5pa_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]}
mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg

SCOPe Domain Coordinates for d1z5pa_:

Click to download the PDB-style file with coordinates for d1z5pa_.
(The format of our PDB-style files is described here.)

Timeline for d1z5pa_: