Lineage for d1z5pa1 (1z5p A:1-232)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 702675Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 702676Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 702725Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (1 species)
  7. 702726Species Escherichia coli [TaxId:562] [82449] (6 PDB entries)
  8. 702731Domain d1z5pa1: 1z5p A:1-232 [124487]
    automatically matched to d1nc3a_
    complexed with gol, ipa, pe5

Details for d1z5pa1

PDB Entry: 1z5p (more details), 2 Å

PDB Description: Crystal structure of MTA/AdoHcy nucleosidase with a ligand-free purine binding site
PDB Compounds: (A:) MTA/SAH nucleosidase

SCOP Domain Sequences for d1z5pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5pa1 c.56.2.1 (A:1-232) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]}
mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg

SCOP Domain Coordinates for d1z5pa1:

Click to download the PDB-style file with coordinates for d1z5pa1.
(The format of our PDB-style files is described here.)

Timeline for d1z5pa1: