Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins) |
Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (1 species) |
Species Escherichia coli [TaxId:562] [82449] (6 PDB entries) |
Domain d1z5pa1: 1z5p A:1-232 [124487] automatically matched to d1nc3a_ complexed with gol, ipa, pe5 |
PDB Entry: 1z5p (more details), 2 Å
SCOP Domain Sequences for d1z5pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5pa1 c.56.2.1 (A:1-232) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]} mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg
Timeline for d1z5pa1: