Lineage for d1z5lc2 (1z5l C:8-185)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719354Protein CD1, alpha-1 and alpha-2 domains [54456] (3 species)
    Class I MHC-related
  7. 719365Species Mouse (Mus musculus) [TaxId:10090] [54457] (6 PDB entries)
  8. 719370Domain d1z5lc2: 1z5l C:8-185 [124484]
    Other proteins in same PDB: d1z5la1, d1z5lb1, d1z5lc1, d1z5ld1
    automatically matched to d1cd1a2
    complexed with nag, pbs, r16

Details for d1z5lc2

PDB Entry: 1z5l (more details), 2.2 Å

PDB Description: structure of a highly potent short-chain galactosyl ceramide agonist bound to cd1d
PDB Compounds: (C:) T-cell surface glycoprotein CD1d antigen

SCOP Domain Sequences for d1z5lc2:

Sequence, based on SEQRES records: (download)

>d1z5lc2 d.19.1.1 (C:8-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr
fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d1z5lc2 d.19.1.1 (C:8-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemysesflhvafqgkyvvrfwgt
swqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOP Domain Coordinates for d1z5lc2:

Click to download the PDB-style file with coordinates for d1z5lc2.
(The format of our PDB-style files is described here.)

Timeline for d1z5lc2: