Lineage for d1z5la2 (1z5l A:8-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938889Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2938916Domain d1z5la2: 1z5l A:8-185 [124481]
    Other proteins in same PDB: d1z5la1, d1z5lb_, d1z5lc1, d1z5ld_
    automated match to d1onqa2
    complexed with nag, pbs, r16

Details for d1z5la2

PDB Entry: 1z5l (more details), 2.2 Å

PDB Description: structure of a highly potent short-chain galactosyl ceramide agonist bound to cd1d
PDB Compounds: (A:) T-cell surface glycoprotein CD1d antigen

SCOPe Domain Sequences for d1z5la2:

Sequence, based on SEQRES records: (download)

>d1z5la2 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr
fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d1z5la2 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypsesflhvafqgkyvvrfwg
tswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d1z5la2:

Click to download the PDB-style file with coordinates for d1z5la2.
(The format of our PDB-style files is described here.)

Timeline for d1z5la2: