Lineage for d1z5la1 (1z5l A:186-279)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654498Protein CD1, alpha-3 domain [88615] (3 species)
  7. 654509Species Mouse (Mus musculus) [TaxId:10090] [88616] (6 PDB entries)
  8. 654513Domain d1z5la1: 1z5l A:186-279 [124480]
    Other proteins in same PDB: d1z5la2, d1z5lb1, d1z5lc2, d1z5ld1
    automatically matched to d1cd1a1
    complexed with nag, pbs, r16

Details for d1z5la1

PDB Entry: 1z5l (more details), 2.2 Å

PDB Description: Structure of a highly potent short-chain galactosyl ceramide agonist bound to CD1D
PDB Compounds: (A:) T-cell surface glycoprotein CD1d antigen

SCOP Domain Sequences for d1z5la1:

Sequence, based on SEQRES records: (download)

>d1z5la1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d1z5la1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa
tldveageeaglacrvkhsslggqdiilyw

SCOP Domain Coordinates for d1z5la1:

Click to download the PDB-style file with coordinates for d1z5la1.
(The format of our PDB-style files is described here.)

Timeline for d1z5la1: