Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein CD1, alpha-3 domain [88615] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88616] (6 PDB entries) |
Domain d1z5la1: 1z5l A:186-279 [124480] Other proteins in same PDB: d1z5la2, d1z5lb1, d1z5lc2, d1z5ld1 automatically matched to d1cd1a1 complexed with nag, pbs, r16 |
PDB Entry: 1z5l (more details), 2.2 Å
SCOP Domain Sequences for d1z5la1:
Sequence, based on SEQRES records: (download)
>d1z5la1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
>d1z5la1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa tldveageeaglacrvkhsslggqdiilyw
Timeline for d1z5la1:
View in 3D Domains from other chains: (mouse over for more information) d1z5lb1, d1z5lc1, d1z5lc2, d1z5ld1 |