SCOPe 2.02: Domain d1z5gd_: 1z5g D:

Lineage for d1z5gd_ (1z5g D:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [142153] (4 PDB entries)
   Uniprot P58683 30-237

8. Domain d1z5gd_: 1z5g D: [124479]
   automated match to d1rm7a_
   complexed with mg, po4

Details for d1z5gd_

PDB Entry: 1z5g, 2 Å

PDB Description: Crystal structure of Salmonella typhimurium AphA protein

PDB Compounds: (D:) AphA protein

SCOPe Domain Sequences for d1z5gd_:

Sequence; same for both SEQRES and ATOM records:

>d1z5gd_ c.108.1.12 (D:) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]}
pstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkt
yspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetv
sktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirg
irilraanstykplpqagafgeevivnsey

Timeline for d1z5gd_:

• d1z5gd_ first appeared in SCOP 1.73, called d1z5gd1
  
• d1z5gd_ appears in SCOPe 2.01
  
• d1z5gd_ appears in SCOPe 2.03
  
• d1z5gd_ appears in the current release, SCOPe 2.08