Lineage for d1z5gd_ (1z5g D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1011080Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
  6. 1011081Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 1011105Species Salmonella typhimurium [TaxId:90371] [142153] (4 PDB entries)
    Uniprot P58683 30-237
  8. 1011109Domain d1z5gd_: 1z5g D: [124479]
    automated match to d1rm7a_
    complexed with mg, po4

Details for d1z5gd_

PDB Entry: 1z5g (more details), 2 Å

PDB Description: Crystal structure of Salmonella typhimurium AphA protein
PDB Compounds: (D:) AphA protein

SCOPe Domain Sequences for d1z5gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5gd_ c.108.1.12 (D:) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]}
pstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkt
yspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetv
sktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirg
irilraanstykplpqagafgeevivnsey

SCOPe Domain Coordinates for d1z5gd_:

Click to download the PDB-style file with coordinates for d1z5gd_.
(The format of our PDB-style files is described here.)

Timeline for d1z5gd_: