Lineage for d1z5gd1 (1z5g D:7-214)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848223Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
  6. 848224Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 848247Species Salmonella typhimurium [TaxId:90371] [142153] (3 PDB entries)
    Uniprot P58683 30-237
  8. 848251Domain d1z5gd1: 1z5g D:7-214 [124479]
    automatically matched to 1Z5G A:7-214
    complexed with mg, po4

Details for d1z5gd1

PDB Entry: 1z5g (more details), 2 Å

PDB Description: Crystal structure of Salmonella typhimurium AphA protein
PDB Compounds: (D:) AphA protein

SCOP Domain Sequences for d1z5gd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5gd1 c.108.1.12 (D:7-214) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]}
tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
tladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirgir
ilraanstykplpqagafgeevivnsey

SCOP Domain Coordinates for d1z5gd1:

Click to download the PDB-style file with coordinates for d1z5gd1.
(The format of our PDB-style files is described here.)

Timeline for d1z5gd1: