Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein) the insertion subdomain is a helical hairpin automatically mapped to Pfam PF03767 |
Protein Class B acid phosphatase, AphA [102308] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [142153] (4 PDB entries) Uniprot P58683 30-237 |
Domain d1z5gd_: 1z5g D: [124479] automated match to d1rm7a_ complexed with mg, po4 |
PDB Entry: 1z5g (more details), 2 Å
SCOPe Domain Sequences for d1z5gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5gd_ c.108.1.12 (D:) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]} pstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkt yspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetv sktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirg irilraanstykplpqagafgeevivnsey
Timeline for d1z5gd_: