Lineage for d1z5gc1 (1z5g C:7-214)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712479Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
  6. 712480Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 712499Species Salmonella typhimurium [TaxId:90371] [142153] (3 PDB entries)
  8. 712502Domain d1z5gc1: 1z5g C:7-214 [124478]
    automatically matched to 1Z5G A:7-214
    complexed with mg, po4

Details for d1z5gc1

PDB Entry: 1z5g (more details), 2 Å

PDB Description: Crystal structure of Salmonella typhimurium AphA protein
PDB Compounds: (C:) AphA protein

SCOP Domain Sequences for d1z5gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5gc1 c.108.1.12 (C:7-214) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 602]}
tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
tladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirgir
ilraanstykplpqagafgeevivnsey

SCOP Domain Coordinates for d1z5gc1:

Click to download the PDB-style file with coordinates for d1z5gc1.
(The format of our PDB-style files is described here.)

Timeline for d1z5gc1: