SCOPe 2.06: Domain d1z5cb3: 1z5c B:4-228

Lineage for d1z5cb3 (1z5c B:4-228)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)

6. Protein Topoisomerase VI-B subunit [82778] (1 species)
   contains an H2TH domain inserted after this domain and before the second family-specific domain

7. Species Sulfolobus shibatae [TaxId:2286] [82779] (7 PDB entries)

8. Domain d1z5cb3: 1z5c B:4-228 [124475]
   Other proteins in same PDB: d1z5ca1, d1z5ca2, d1z5cb1, d1z5cb2
   automated match to d2hkja3
   complexed with adp, mg, po4

Details for d1z5cb3

PDB Entry: 1z5c, 2.2 Å

PDB Description: Topoisomerase VI-B, ADP Pi bound dimer form

PDB Compounds: (B:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1z5cb3:

Sequence; same for both SEQRES and ATOM records:

>d1z5cb3 d.122.1.2 (B:4-228) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]}
kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka
ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqe

Timeline for d1z5cb3:

• d1z5cb3 first appeared in SCOP 1.73
  
• d1z5cb3 appears in SCOPe 2.05
  
• d1z5cb3 appears in SCOPe 2.07
  
• d1z5cb3 appears in the current release, SCOPe 2.08