Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins) |
Protein Topoisomerase VI-B subunit [82778] (1 species) contains an H2TH domain inserted after this domain and before the second family-specific domain |
Species Sulfolobus shibatae [TaxId:2286] [82779] (7 PDB entries) |
Domain d1z5ca3: 1z5c A:4-228 [124472] Other proteins in same PDB: d1z5ca1, d1z5ca2, d1z5cb1, d1z5cb2 automated match to d2hkja3 complexed with adp, mg, po4 |
PDB Entry: 1z5c (more details), 2.2 Å
SCOPe Domain Sequences for d1z5ca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5ca3 d.122.1.2 (A:4-228) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]} kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqe
Timeline for d1z5ca3: