Lineage for d1z5ca1 (1z5c A:229-306)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017655Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2017656Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2017788Family a.156.1.3: Topoisomerase VI-B subunit middle domain [81705] (1 protein)
    automatically mapped to Pfam PF05833
  6. 2017789Protein Topoisomerase VI-B subunit middle domain [81706] (1 species)
  7. 2017790Species Sulfolobus shibatae [TaxId:2286] [81707] (7 PDB entries)
  8. 2017796Domain d1z5ca1: 1z5c A:229-306 [124470]
    Other proteins in same PDB: d1z5ca2, d1z5ca3, d1z5cb2, d1z5cb3
    automated match to d2hkja1
    complexed with adp, mg, po4

Details for d1z5ca1

PDB Entry: 1z5c (more details), 2.2 Å

PDB Description: Topoisomerase VI-B, ADP Pi bound dimer form
PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1z5ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5ca1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Sulfolobus shibatae [TaxId: 2286]}
vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl
teeeitrlvetfkkyedf

SCOPe Domain Coordinates for d1z5ca1:

Click to download the PDB-style file with coordinates for d1z5ca1.
(The format of our PDB-style files is described here.)

Timeline for d1z5ca1: