SCOPe 2.03: Domain d1z5bb1: 1z5b B:229-306

Lineage for d1z5bb1 (1z5b B:229-306)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (3 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.3: Topoisomerase VI-B subunit middle domain [81705] (1 protein)
   automatically mapped to Pfam PF05833

6. Protein Topoisomerase VI-B subunit middle domain [81706] (1 species)

7. Species Sulfolobus shibatae [TaxId:2286] [81707] (7 PDB entries)

8. Domain d1z5bb1: 1z5b B:229-306 [124467]
   Other proteins in same PDB: d1z5ba2, d1z5ba3, d1z5bb2, d1z5bb3
   automatically matched to d1mu5a1
   complexed with adp, alf, mg, so4

Details for d1z5bb1

PDB Entry: 1z5b, 2 Å

PDB Description: Topoisomerase VI-B, ADP AlF4- bound dimer form

PDB Compounds: (B:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1z5bb1:

Sequence; same for both SEQRES and ATOM records:

>d1z5bb1 a.156.1.3 (B:229-306) Topoisomerase VI-B subunit middle domain {Sulfolobus shibatae [TaxId: 2286]}
vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl
teeeitrlvetfkkyedf

Timeline for d1z5bb1:

• d1z5bb1 first appeared in SCOP 1.73
  
• d1z5bb1 appears in SCOPe 2.02
  
• d1z5bb1 appears in SCOPe 2.04
  
• d1z5bb1 appears in the current release, SCOPe 2.08