Class a: All alpha proteins [46456] (290 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.3: Topoisomerase VI-B subunit middle domain [81705] (1 protein) automatically mapped to Pfam PF05833 |
Protein Topoisomerase VI-B subunit middle domain [81706] (1 species) |
Species Sulfolobus shibatae [TaxId:2286] [81707] (7 PDB entries) |
Domain d1z5ba1: 1z5b A:229-306 [124464] Other proteins in same PDB: d1z5ba2, d1z5ba3, d1z5bb2, d1z5bb3 automated match to d2hkja1 complexed with adp, alf, mg, so4 |
PDB Entry: 1z5b (more details), 2 Å
SCOPe Domain Sequences for d1z5ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5ba1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Sulfolobus shibatae [TaxId: 2286]} vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl teeeitrlvetfkkyedf
Timeline for d1z5ba1: