![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins) |
![]() | Protein Topoisomerase VI-B subunit [82577] (1 species) contains an H2TH domain inserted in front of this domain and after the N-terminal ATPase domain |
![]() | Species Sulfolobus shibatae [TaxId:2286] [82578] (7 PDB entries) |
![]() | Domain d1z5ab2: 1z5a B:307-463 [124462] Other proteins in same PDB: d1z5aa1, d1z5aa3, d1z5ab1, d1z5ab3 automated match to d2hkja2 complexed with adp, mg |
PDB Entry: 1z5a (more details), 2.2 Å
SCOPe Domain Sequences for d1z5ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5ab2 d.14.1.3 (B:307-463) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]} rspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvge epivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksag kesiaevediekeiknalmevarklkqylsekrkeqe
Timeline for d1z5ab2: