Lineage for d1z54d_ (1z54 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943631Protein Probable thioesterase TTHA0908 [143152] (1 species)
  7. 2943632Species Thermus thermophilus [TaxId:274] [143153] (1 PDB entry)
    Uniprot Q5SJV0 1-132
  8. 2943636Domain d1z54d_: 1z54 D: [124453]
    automated match to d1z54a1
    complexed with gol

Details for d1z54d_

PDB Entry: 1z54 (more details), 2.1 Å

PDB Description: Crystal structure of a hypothetical protein TT1821 from Thermus thermophilus
PDB Compounds: (D:) probable thioesterase

SCOPe Domain Sequences for d1z54d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z54d_ d.38.1.1 (D:) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}
mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraaripe
diyralsvlh

SCOPe Domain Coordinates for d1z54d_:

Click to download the PDB-style file with coordinates for d1z54d_.
(The format of our PDB-style files is described here.)

Timeline for d1z54d_: