SCOPe 2.07: Domain d1z54c_: 1z54 C:

Lineage for d1z54c_ (1z54 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Probable thioesterase TTHA0908 [143152] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143153] (1 PDB entry)
   Uniprot Q5SJV0 1-132

8. Domain d1z54c_: 1z54 C: [124452]
   automated match to d1z54a1
   complexed with gol

Details for d1z54c_

PDB Entry: 1z54, 2.1 Å

PDB Description: Crystal structure of a hypothetical protein TT1821 from Thermus thermophilus

PDB Compounds: (C:) probable thioesterase

SCOPe Domain Sequences for d1z54c_:

Sequence; same for both SEQRES and ATOM records:

>d1z54c_ d.38.1.1 (C:) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}
esvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelgl
tfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraariped
iyralsvlh

Timeline for d1z54c_:

• d1z54c_ first appeared in SCOP 1.73, called d1z54c1
  
• d1z54c_ appears in SCOPe 2.06
  
• d1z54c_ appears in the current release, SCOPe 2.08