![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (18 proteins) Pfam PF03061 |
![]() | Protein Probable thioesterase TTHA0908 [143152] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143153] (1 PDB entry) Uniprot Q5SJV0 1-132 |
![]() | Domain d1z54c1: 1z54 C:2-130 [124452] automatically matched to 1Z54 A:1-132 complexed with gol |
PDB Entry: 1z54 (more details), 2.1 Å
SCOP Domain Sequences for d1z54c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z54c1 d.38.1.1 (C:2-130) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} esvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelgl tfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraariped iyralsvlh
Timeline for d1z54c1: